A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10103
Swiss-prot Accession number	P82014 (Sequence in FASTA format)
Description	Diuretic hormone 1 (DH-1) (Diuretic peptide 1) (DP-1) (DH(41)).
Source organism	Hyles lineata (Whitelined sphinx moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Macroglossinae; Hyles.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules
Protein Length	41 Amino acids
Molecular weight	4724
References	1  PubMed abstract 10696588
Domain Name	CRF
Hormone Name	Diuretic hormone 1
Mature Hormone Sequence	RMPSLSIDLPMSVLRQKLSLEKERKVQALRAAANRNFLNDI
Position of mature hormone in Pre-Hormone protein	41 Residues from position (1-41)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10104
Swiss-prot Accession number	P82015 (Sequence in FASTA format)
Description	Diuretic hormone 2 (DH-2) (Diuretic peptide 2) (DP-2) (DH(30)).
Source organism	Hyles lineata (Whitelined sphinx moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Macroglossinae; Hyles.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Regulation of fluid secretion. May stimulate primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules
Protein Length	30 Amino acids
Molecular weight	3575
References	1  PubMed abstract 10696588
Domain Name	CRF
Hormone Name	Diuretic hormone 2
Mature Hormone Sequence	SFSVNPAVEILQHRYMEKVAQNNRNFLNRV
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated